Protein Labeling Reagents
CPC Scientific TAMRA-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH (trifluoroacetate salt) 0.5MG
beta-Amyloid (1-40) found to exhibit both neurotrophic and neurotoxic effects that depend on neuronal age and beta-protein concentration.ONE-LETTER SEQUENCE: TAMRA-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVMOLECULAR FORMULA: C219H315N55O62S1MOLECULAR WEIGHT:4742.4STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [1802087-81-5], SYNONYMS: 5-TAMRA-Amyloid β-Protein (1-40)RESEARCH AREA: Alzheimer's DiseaseREFERENCES: B.A. Yankner et al., Science, 250, 279 (1990)
Apexbio Technology LLC Cy3.5 maleimide (non-sulfonated), 5mg. Cas: N/A MFCD: NA. Labeling of cysteine residues, as well as other thiolated molecules
Cy3.5 maleimide can be used for selective labeling of free sulfhydryl groups (e.g. cysteine residues in peptides, proteins and oligonucleotides). Before labeling, cystines should be prepared with reductant such as TCEP (tris-carboxyethylphosphine). Other sizes are available. Please inqury us for quote.
Biotium 5-(AND-6)-CARBOXYTetramethylrhodamine SU
5(6)-TAMRA SE (full name: 5-(and-6)-Carboxytetramethylrhodamine succinimidyl ester (mixed isomers)) is the amine reactive form of TAMRA, one of the most commonly used red fluorescent dyes. The succinimidyl ester reacts readily with primary or secondary amines under mild conditions. Properties: Ex/Em (MeOH) = 540/565 nm; e = 95,000; Red solid soluble in DMF or DMSO; Store at -20°C and protect from light; C 29 H 25 N 3 O 7; MW: 527.5; [150408-83-6]
Kyfora Bio Stains-all 5g
Stains-all is a carbocyanine dye that can be used to stain DNA and RNA as well as anionic proteins and polysaccharides In buffer solution stains-all has an absorption maxima near 570 nm and an emission maxima near 650 nm
Medchemexpress LLC Cy7-yne | 95.0% | 10 MG
Cy7-YNE is a near-infrared cyanine fluorescent labeling reagent containing an alkyne functional group for click chemistry and conjugation to biomolecules. It is used to label proteins, antibodies, and peptides for fluorescence-based detection in the ~700-790 nm spectral region.
- Near-infrared cyanine dye suitable for biomolecule labeling.
- Contains an alkyne group for copper-catalyzed azide-alkyne cycloaddition (CuAAC).
- Optimized for excitation around 700-770 nm and emission near 770-790 nm.
- Available in milligram pack sizes for research use.
- Solid form with ≥95.0% purity.
- Store protected from light; in solvent: -80°C for long-term, -20°C for short-term.
Apexbio Technology LLC Cy3.5 maleimide (non-sulfonated), 25mg. Cas: N/A MFCD: NA. Labeling of cysteine residues, as well as other thiolated molecules
Cy3.5 maleimide can be used for selective labeling of free sulfhydryl groups (e.g. cysteine residues in peptides, proteins and oligonucleotides). Before labeling, cystines should be prepared with reductant such as TCEP (tris-carboxyethylphosphine). Other sizes are available. Please inqury us for quote.
Medchemexpress LLC HY-D0818 5mg Medchemexpress, CY3-YNE CAS:1010386-62-5 Purity:>98%
Medchemexpress, HY-D0818 5mg CY3-YNE CAS:1010386-62-5 Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Medchemexpress LLC Cy5-PEG3-azide | 00-00-0 | MFCD28142475 | 99.5% | 719.36 | C40H55ClN6O4 | 5 MG
Cy5-PEG3-azide is a PEG-based linker dye bearing an azide group for bioorthogonal conjugation. It is designed for use in click chemistry and linker-dependent constructs, enabling efficient attachment to alkyne-bearing partners for bioconjugation and PROTAC synthesis.
- PEG-based linker with azide functionality for click chemistry.
- Compatible with copper-catalyzed and strain-promoted azide-alkyne cycloaddition.
- Suitable for PROTAC synthesis and general bioconjugation workflows.
- High purity for reliable analytical and preparative results.
- Store at -20°C and protect from light; in solution, store at -80°C for long-term.
CPC Scientific TAMRA-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH (trifluoroacetate salt) 0.5MG
Brain natriuretic peptide or B-type natriuretic peptide (BNP) (also ventricular natriuretic peptide) is a 32-amino acid peptide secreted by heart ventricles in response to excessive stretching of heart muscle cells (cardiomyocytes).ONE-LETTER SEQUENCE: TAMRA-SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Cys10 and 26 bridge)MOLECULAR FORMULA: C168H266N52O46S4MOLECULAR WEIGHT:3878.6STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [114471-18-0], RESEARCH AREA: CardiovascularREFERENCES: T. Sudoh et al., BBRC, 159, 1427 (1989)